Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCGRT Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Fc fragment of IgG receptor and transporter

Gene Aliases

Alpha-chain; Fc fragment of IgG, receptor, transporter, alpha; FCRN; FcRn alpha chain; heavy chain of the major histocompatibility complex class I-like Fc receptor; IgG Fc fragment receptor transporter alpha chain; IgG receptor FcRn large subunit p51; immunoglobulin receptor, intestinal, heavy chain; major histocompatibility complex class I-like Fc receptor; neonatal Fc receptor; neonatal Fc-receptor for Ig; transmembrane alpha chain of the neonatal receptor.

Gene ID

2217

Accession Number

NP_001129491.1

Reactivity

Homo sapiens|Human

Target

Binds to the Fc region of monomeric immunoglobulins gamma (PubMed:7964511, PubMed:10933786) . Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity) . Possible role in transfer of immunoglobulin G from mother to fetus (PubMed:7964511) .

Type

Protein

Source

E.coli

Sequence

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

57.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FCGRT

Host or Source

Human

Protein Name

IgG receptor FcRn large subunit p51

Gene Name URL

FCGRT

Nucleotide Accession Number

NM_001136019.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR-1B shRNA (m) Lentiviral Particles
sc-42224-V 200 µL

SR-1B shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
pECMV-Lpar3-m-FLAG Plasmid
PVT15285 2 µg

pECMV-Lpar3-m-FLAG Plasmid

Sign In for Pricing
View Details
NUDT2 siRNA (Rat)
MBS8219155-01 15 nmol

NUDT2 siRNA (Rat)

Sign In for Pricing
View Details
NUDT2 siRNA (Rat)
MBS8219155-02 30 nmol

NUDT2 siRNA (Rat)

Sign In for Pricing
View Details
NUDT2 siRNA (Rat)
MBS8219155-03 5x 30 nmol

NUDT2 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Mouse Lysyl oxidase homolog 1 Protein, His, Yeast-200ug
QP6316-ye-200ug 200ug

Recombinant Mouse Lysyl oxidase homolog 1 Protein, His, Yeast-200ug

Sign In for Pricing
View Details