What is the catalog number for FASLG Recombinant Protein?

The catalog number for FASLG Recombinant Protein is OPCA01596-100UG.

What sizes are available for FASLG Recombinant Protein?

FASLG Recombinant Protein is available in the following size(s): 100 µg.

Is FASLG Recombinant Protein in stock?

FASLG Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

FASLG Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Fas ligand

Gene Aliases

ALPS1B; apoptosis (APO-1) antigen ligand 1; apoptosis antigen ligand; APT1LG1; APTL; CD178; CD95 ligand; CD95L; CD95-L; fas antigen ligand; Fas ligand (TNF superfamily, member 6) ; FASL; mutant tumor necrosis factor family member 6; TNFSF6; TNLG1A; tumor necrosis factor ligand 1A; tumor necrosis factor ligand superfamily member 6.

Gene ID

356

Accession Number

NP_000630.1

Reactivity

Homo sapiens|Human

Target

Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells (PubMed:26334989, PubMed:9228058) . Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development (PubMed:9228058, PubMed:7528780, PubMed:9427603) . Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses (By similarity) . TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance (By similarity) . Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis (PubMed:27806260) .

Type

Protein

Source

E.coli

Sequence

QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.