Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Coagulation factor V

Gene Aliases

Activated protein c cofactor; coagulation factor V; coagulation factor V (proaccelerin, labile factor) ; coagulation factor V jinjiang A2 domain; factor V Leiden; FVL; PCCF; Proaccelerin, labile factor; RPRGL1; THPH2.

Gene ID

2153

Accession Number

NP_000121.2

Reactivity

Homo sapiens|Human

Target

Central regulator of hemostasis. It serves as a critical cofactor for the prothrombinase activity of factor Xa that results in the activation of prothrombin to thrombin.

Type

Protein

Source

E.coli

Sequence

MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

F5

Host or Source

Human

Protein Name

Coagulation factor V

Gene Name URL

F5

Nucleotide Accession Number

NM_000130.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC3L2 Antibody (N-term) Blocking Peptide
MBS9225478-01 0.5 mg

EXOC3L2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
EXOC3L2 Antibody (N-term) Blocking Peptide
MBS9225478-02 5x 0.5 mg

EXOC3L2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Gelsolin (GS) BioAssayTM ELISA Kit (Human)
025261 96 Tests

Gelsolin (GS) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse Dedicator of cytokinesis protein 1, DOCK1 ELISA Kit
MBS1604891-01 48 Well

Mouse Dedicator of cytokinesis protein 1, DOCK1 ELISA Kit

Sign In for Pricing
View Details
Mouse Dedicator of cytokinesis protein 1, DOCK1 ELISA Kit
MBS1604891-02 96 Well

Mouse Dedicator of cytokinesis protein 1, DOCK1 ELISA Kit

Sign In for Pricing
View Details
Mouse Dedicator of cytokinesis protein 1, DOCK1 ELISA Kit
MBS1604891-03 5x 96 Well

Mouse Dedicator of cytokinesis protein 1, DOCK1 ELISA Kit

Sign In for Pricing
View Details