Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4EBP3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Eukaryotic translation initiation factor 4E binding protein 3

Gene Aliases

4EBP3;4E-BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3.

Gene ID

8637

Accession Number

NP_003723.1

Reactivity

Homo sapiens|Human

Target

Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.

Type

Protein

Source

E.coli

Sequence

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EIF4EBP3

Host or Source

Human

Protein Name

Eukaryotic translation initiation factor 4E-binding protein 3

Gene Name URL

EIF4EBP3

Nucleotide Accession Number

NM_003732.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

LARG Antibody / ARHGEF12
RQ6941 100 µg

LARG Antibody / ARHGEF12

Sign In for Pricing
View Details
TRP1 Antibody / Tyrosinase-Related Protein-1 Antibody / TYRP1
V3174-100UG 100 µg

TRP1 Antibody / Tyrosinase-Related Protein-1 Antibody / TYRP1

Sign In for Pricing
View Details
(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid
OR95566-01 5 g

(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid

Sign In for Pricing
View Details
(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid
OR95566-02 25 g

(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid

Sign In for Pricing
View Details
(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid
OR95566-03 100 g

(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid

Sign In for Pricing
View Details
(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid
OR95566-04 500 g

(R) -2- (((Benzyloxy) carbonyl) amino) butanoic acid

Sign In for Pricing
View Details