Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Efnb3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ephrin B3

Gene Aliases

EFL-; EFL-6; ELF-; ELF-3; Elk-; Elk-L3; Ep; ephrin-B3; Epl8; LERK; LERK-8; NLER; NLERK-2.

Gene ID

13643

Accession Number

NP_031937.1

Reactivity

Mouse|Mus musculus

Target

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.

Type

Protein

Source

E.coli

Sequence

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Efnb3

Host or Source

Mouse

Protein Name

Ephrin-B3

Gene Name URL

Efnb3

Nucleotide Accession Number

NM_007911.5

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepacam Mouse siRNA Oligo Duplex (Locus ID 72927)
SR413883 1 Kit

Hepacam Mouse siRNA Oligo Duplex (Locus ID 72927)

Sign In for Pricing
View Details
Mouse Transcription factor AP-2-beta ELISA Kit
MBS2887606-01 48 Well

Mouse Transcription factor AP-2-beta ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription factor AP-2-beta ELISA Kit
MBS2887606-02 96 Well

Mouse Transcription factor AP-2-beta ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription factor AP-2-beta ELISA Kit
MBS2887606-03 5x 96 Well

Mouse Transcription factor AP-2-beta ELISA Kit

Sign In for Pricing
View Details
Mouse Transcription factor AP-2-beta ELISA Kit
MBS2887606-04 10x 96 Well

Mouse Transcription factor AP-2-beta ELISA Kit

Sign In for Pricing
View Details
PMS2 Rabbit mAb
C06046-100uL 100 µL

PMS2 Rabbit mAb

Sign In for Pricing
View Details