Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1E1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Eukaryotic translation elongation factor 1 epsilon 1

Gene Aliases

AIMP3; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; Elongation factor p18; eukaryotic translation elongation factor 1 epsilon-1; multisynthase complex auxiliary component p18; P18; p18 component of aminoacyl-tRNA synthetase complex.

Gene ID

9521

Accession Number

NP_001129122.1

Reactivity

Homo sapiens|Human

Target

Positive modulator of ATM response to DNA damage.

Type

Protein

Source

E.coli

Sequence

AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EEF1E1

Host or Source

Human

Protein Name

Eukaryotic translation elongation factor 1 epsilon-1

Gene Name URL

EEF1E1

Nucleotide Accession Number

NM_001135650.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)
MBS1233887-01 0.02 mg (E-Coli)

Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)
MBS1233887-02 0.02 mg (Yeast)

Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)
MBS1233887-03 0.1 mg (E-Coli)

Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)
MBS1233887-04 0.1 mg (Yeast)

Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)
MBS1233887-05 0.02 mg (Baculovirus)

Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details
Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)
MBS1233887-06 0.02 mg (Mammalian-Cell)

Recombinant Streptococcus uberis Peptide chain release factor 2 (prfB)

Sign In for Pricing
View Details