What is the catalog number for EEF1E1 Recombinant Protein?

The catalog number for EEF1E1 Recombinant Protein is OPCA01576-1MG.

What sizes are available for EEF1E1 Recombinant Protein?

EEF1E1 Recombinant Protein is available in the following size(s): 1 mg.

Is EEF1E1 Recombinant Protein in stock?

EEF1E1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

EEF1E1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Eukaryotic translation elongation factor 1 epsilon 1

Gene Aliases

AIMP3; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; Elongation factor p18; eukaryotic translation elongation factor 1 epsilon-1; multisynthase complex auxiliary component p18; P18; p18 component of aminoacyl-tRNA synthetase complex.

Gene ID

9521

Accession Number

NP_001129122.1

Reactivity

Homo sapiens|Human

Target

Positive modulator of ATM response to DNA damage.

Type

Protein

Source

E.coli

Sequence

AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.