Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP14 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Dual specificity phosphatase 14

Gene Aliases

Dual specificity protein phosphatase 14; MAP kinase phosphatase 6; mitogen-activated protein kinase phosphatase 6; MKP-1-like protein tyrosine phosphatase; MKP6; MKP-6; MKP-L.

Gene ID

11072

Reactivity

Homo sapiens|Human

Target

Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.

Type

Protein

Source

E.coli

Sequence

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DUSP14

Host or Source

Human

Protein Name

Dual specificity protein phosphatase 14

Gene Name URL

DUSP14

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULBP3 Protein Lysate (Human) with C-Ha Tag
49160031 100 µg

ULBP3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Influenza B (Biotin) discontinued
I7651-05D-Biotin 100 µL

Influenza B (Biotin) discontinued

Sign In for Pricing
View Details
Mouse MARCO Alexa Fluor 405 MAb (Cl 579511)
FAB2956V-100UG 100 µg

Mouse MARCO Alexa Fluor 405 MAb (Cl 579511)

Sign In for Pricing
View Details
Anti-Endothelial Protein C Receptor (EPCR)
FY-AB46521-01 1 mL

Anti-Endothelial Protein C Receptor (EPCR)

Sign In for Pricing
View Details
Anti-Endothelial Protein C Receptor (EPCR)
FY-AB46521-02 100 µL

Anti-Endothelial Protein C Receptor (EPCR)

Sign In for Pricing
View Details
Anti-Endothelial Protein C Receptor (EPCR)
FY-AB46521-03 200 µL

Anti-Endothelial Protein C Receptor (EPCR)

Sign In for Pricing
View Details