What is the catalog number for CTAG2 Recombinant Protein?

The catalog number for CTAG2 Recombinant Protein is OPCA01545-20UG.

What sizes are available for CTAG2 Recombinant Protein?

CTAG2 Recombinant Protein is available in the following size(s): 20 µg.

Is CTAG2 Recombinant Protein in stock?

CTAG2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

CTAG2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cancer/testis antigen 2

Gene Aliases

Autoimmunogenic cancer/testis antigen NY-ESO-2; CAMEL; cancer/testis antigen 2; cancer/testis antigen 6.2; cancer/testis antigen family 6, member 2a; cancer/testis antigen family 6, member 2b; CT2; CT6.2; CT6.2a; CT6.2b; CTL-recognized antigen on melanoma; ESO2; l antigen family member 1; LAGE-1; LAGE-1a protein; LAGE2B.

Gene ID

30848

Accession Number

NP_066274.2

Reactivity

Homo sapiens|Human

Target

This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID:10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants.

Type

Protein

Source

E.coli

Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CTAG2

Host or Source

Human

Protein Name

Cancer/testis antigen 2

Gene Name URL

CTAG2

Nucleotide Accession Number

NM_020994.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

BNC880008-100 1x 100 µL