Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTAG2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cancer/testis antigen 2

Gene Aliases

Autoimmunogenic cancer/testis antigen NY-ESO-2; CAMEL; cancer/testis antigen 2; cancer/testis antigen 6.2; cancer/testis antigen family 6, member 2a; cancer/testis antigen family 6, member 2b; CT2; CT6.2; CT6.2a; CT6.2b; CTL-recognized antigen on melanoma; ESO2; l antigen family member 1; LAGE-1; LAGE-1a protein; LAGE2B.

Gene ID

30848

Accession Number

NP_066274.2

Reactivity

Homo sapiens|Human

Target

This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID:10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants.

Type

Protein

Source

E.coli

Sequence

MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CTAG2

Host or Source

Human

Protein Name

Cancer/testis antigen 2

Gene Name URL

CTAG2

Nucleotide Accession Number

NM_020994.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rmdn3 Antibody
orb801780 2 mg

Rmdn3 Antibody

Sign In for Pricing
View Details
Rat Monoclonal Caspase-11 Antibody (8A5) [Alexa Fluor 647]
NBP2-80099AF647 0.1 mL

Rat Monoclonal Caspase-11 Antibody (8A5) [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Human Serine racemase(SRR)
AP74417-01 20 µg

Recombinant Human Serine racemase(SRR)

Sign In for Pricing
View Details
Recombinant Human Serine racemase(SRR)
AP74417-02 100 µg

Recombinant Human Serine racemase(SRR)

Sign In for Pricing
View Details
Recombinant Human Serine racemase(SRR)
AP74417-03 1 mg

Recombinant Human Serine racemase(SRR)

Sign In for Pricing
View Details
2- ({[ (1R) -1-Phenylethyl]amino}methyl) -3,4-dihydroquinazolin-4-one
GGC39275-01 50 mg

2- ({[ (1R) -1-Phenylethyl]amino}methyl) -3,4-dihydroquinazolin-4-one

Sign In for Pricing
View Details