Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX4I1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytochrome c oxidase subunit 4I1

Gene Aliases

COX IV-1; COX4; COX4-1; COXIV; COXIV-1; cytochrome c oxidase polypeptide IV; cytochrome c oxidase subunit 4 isoform 1, mitochondrial; cytochrome c oxidase subunit IV; Cytochrome c oxidase subunit IV isoform 1; MC4DN16.

Gene ID

1327

Accession Number

NP_001852.1

Reactivity

Homo sapiens|Human

Target

This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Type

Protein

Source

E.coli

Sequence

AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

COX4I1

Host or Source

Human

Protein Name

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

Gene Name URL

COX4I1

Nucleotide Accession Number

NM_001861.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mu-protocadherin/Cdhr5 Recombinant Protein
PROTQ8VHF2-01 10 µg

Mouse Mu-protocadherin/Cdhr5 Recombinant Protein

Sign In for Pricing
View Details
Mouse Mu-protocadherin/Cdhr5 Recombinant Protein
PROTQ8VHF2-02 250 µg

Mouse Mu-protocadherin/Cdhr5 Recombinant Protein

Sign In for Pricing
View Details
PPAPDC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
37294064 1.0 µg DNA

PPAPDC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse BTB/POZ domain-containing protein 3 (BTBD3) ELISA Kit
MBS7238821-01 48 Well

Mouse BTB/POZ domain-containing protein 3 (BTBD3) ELISA Kit

Sign In for Pricing
View Details
Mouse BTB/POZ domain-containing protein 3 (BTBD3) ELISA Kit
MBS7238821-02 96 Well

Mouse BTB/POZ domain-containing protein 3 (BTBD3) ELISA Kit

Sign In for Pricing
View Details
Mouse BTB/POZ domain-containing protein 3 (BTBD3) ELISA Kit
MBS7238821-03 5x 96 Well

Mouse BTB/POZ domain-containing protein 3 (BTBD3) ELISA Kit

Sign In for Pricing
View Details