Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIAO1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cytosolic iron-sulfur assembly component 1

Gene Aliases

CIA1; cytosolic iron-sulfur protein assembly 1 homolog; probable cytosolic iron-sulfur protein assembly protein CIAO1; WD repeat domain 39; WD repeat-containing protein 39; WD40 protein Ciao1; WDR39.

Gene ID

9391

Accession Number

NP_004795.1

Reactivity

Homo sapiens|Human

Target

Key component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.

Type

Protein

Source

E.coli

Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CIAO1

Host or Source

Human

Protein Name

Probable cytosolic iron-sulfur protein assembly protein CIAO1

Gene Name URL

CIAO1

Nucleotide Accession Number

NM_004804.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H8 Recombinant Protein (Rat)
RP237962 100 µg

ZC3H8 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)
MBS7011441-01 0.02 mg

Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)

Sign In for Pricing
View Details
Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)
MBS7011441-02 0.1 mg

Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)

Sign In for Pricing
View Details
Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)
MBS7011441-03 5x 0.1 mg

Recombinant Rat Muscarinic acetylcholine receptor M4 (Chrm4)

Sign In for Pricing
View Details
Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (APC)
MBS6124823-01 0.1 mL

Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (APC)

Sign In for Pricing
View Details
Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (APC)
MBS6124823-02 5x 0.1 mL

Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (APC)

Sign In for Pricing
View Details