Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cd74 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)

Gene Aliases

C; class II-associated invariant chain peptide; CLIP; DHLAG; dinucleotide microsatellite; H-2 class II histocompatibility antigen gamma chain; histocompatibility: class II antigens, gamma chain of; HLADG; HLA-DR-GAMMA; ia antigen-associated invariant chain; Ia-associated invariant chain; Ia-GAMMA; Ii; ii chain; invariant polypeptide of major histocompatibility complex, class II antigen-associated; MHC class II-associated invariant chain.

Gene ID

16149

Accession Number

NP_001036070.1

Reactivity

Mouse|Mus musculus

Target

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Type

Protein

Source

E.coli

Sequence

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cd74

Host or Source

Mouse

Protein Name

H-2 class II histocompatibility antigen gamma chain

Gene Name URL

Cd74

Nucleotide Accession Number

NM_001042605.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6681107 1.0 µg DNA

Phospho1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Beta I Tubulin Antibody, mAb, Rabbit
A02370-100 100 µL

Beta I Tubulin Antibody, mAb, Rabbit

Sign In for Pricing
View Details
RPAIN Rabbit Polyclonal Antibody
orb3068811-01 30 µL

RPAIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPAIN Rabbit Polyclonal Antibody
orb3068811-02 50 µL

RPAIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPAIN Rabbit Polyclonal Antibody
orb3068811-03 100 µL

RPAIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPAIN Rabbit Polyclonal Antibody
orb3068811-04 200 µL

RPAIN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details