What is the catalog number for C5 Recombinant Protein?

The catalog number for C5 Recombinant Protein is OPCA01493-100UG.

What sizes are available for C5 Recombinant Protein?

C5 Recombinant Protein is available in the following size(s): 100 µg.

Is C5 Recombinant Protein in stock?

C5 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

C5 Recombinant Protein

Selected Variant

OPCA01493-100UG

Size: 100 µg

Product Specifications

CAS Number

9000-83-3

Gene Name

Complement C5

Gene Aliases

Anaphylatoxin C5a analog; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5a; C5a anaphylatoxin; C5b; C5D; complement C5; complement component 5; CPAMD4; ECLZB; prepro-C5.

Gene ID

727

Accession Number

NP_001726.2

Reactivity

Homo sapiens|Human

Target

Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.

Type

Protein

Source

E.coli

Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Host or Source

Human

Protein Name

Complement C5

Gene Name URL

Nucleotide Accession Number

NM_001735.2

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LRRC75B Antibody Picoband®, APC Conjugate

A18683-1-APC 100 µg/Vial