Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Butyrophilin subfamily 3 member A1

Gene Aliases

BT3.1; BTF5; BTN3.1; butyrophilin subfamily 3 member A1; CD277; dJ45P21.3 (butyrophilin, subfamily 3, member A1) .

Gene ID

11119

Accession Number

NP_001138480.1

Reactivity

Homo sapiens|Human

Target

Plays a role in T-cell activation and in the adaptive immune response. Regulates the proliferation of activated T-cells. Regulates the release of cytokines and IFNG by activated T-cells. Mediates the response of T-cells toward infected and transformed cells that are characterized by high levels of phosphorylated metabolites, such as isopentenyl pyrophosphate.

Type

Protein

Source

E.coli

Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BTN3A1

Host or Source

Human

Protein Name

Butyrophilin subfamily 3 member A1

Gene Name URL

BTN3A1

Nucleotide Accession Number

NM_001145008.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akirin1 (NM_001030054) Rat Tagged Lenti ORF Clone
RR215493L3 10 µg

Akirin1 (NM_001030054) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Chicken Annexin A5 (ANXA5) ELISA Kit
abx250028-01 96 Tests

Chicken Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
Chicken Annexin A5 (ANXA5) ELISA Kit
abx250028-02 5x 96 Tests

Chicken Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
Chicken Annexin A5 (ANXA5) ELISA Kit
abx250028-03 10x 96 Tests

Chicken Annexin A5 (ANXA5) ELISA Kit

Sign In for Pricing
View Details
TPMT Polyclonal Antibody
A51617-020 20 µL

TPMT Polyclonal Antibody

Sign In for Pricing
View Details
HnRNP G-T (1B14) Rabbit Monoclonal Antibody
E28G2540 100 µL

HnRNP G-T (1B14) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details