Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Birc5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Baculoviral IAP repeat-containing 5

Gene Aliases

A; AAC-11; Api4; apoptosis inhibitor 4; apoptosis inhibitor survivin; baculoviral IAP repeat-containing protein 5; s; survivin; survivin40; T; TIAP.

Gene ID

11799

Accession Number

NP_001012273.1

Reactivity

Mouse|Mus musculus

Target

Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. Involved in the recruitment of CPC to centromeres during early mitosis via association with histone H3 phosphorylated at 'Thr-3' (H3pT3) during mitosis. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.

Type

Protein

Source

E.coli

Sequence

MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Birc5

Host or Source

Mouse

Protein Name

Baculoviral IAP repeat-containing protein 5

Gene Name URL

Birc5

Nucleotide Accession Number

NM_001012273.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN11-set siRNA/shRNA/RNAi Lentivector (Human)
38147091 4x 500 ng

PTPN11-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
FAM134C Double Nickase Plasmid (h2)
sc-408585-NIC-2 20 µg

FAM134C Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (MaxLight 405)
MBS6357862-01 0.1 mL

TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (MaxLight 405)

Sign In for Pricing
View Details
TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (MaxLight 405)
MBS6357862-02 5x 0.1 mL

TRAF3IP1, ID (TRAF3IP1, MIPT3, TRAF3-interacting protein 1, Interleukin-13 receptor alpha 1-binding protein 1, Microtubule-interacting protein associated with TRAF3) (MaxLight 405)

Sign In for Pricing
View Details
PSMA monoclonal antibody
orb1495476-01 50 μL

PSMA monoclonal antibody

Sign In for Pricing
View Details
PSMA monoclonal antibody
orb1495476-02 100 µL

PSMA monoclonal antibody

Sign In for Pricing
View Details