Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2L11 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

BCL2 like 11

Gene Aliases

BAM; bcl-2 interacting mediator of cell death; bcl-2 interacting protein Bim; Bcl2-interacting mediator of cell death; BCL2-like 11 (apoptosis facilitator) ; bcl-2-like protein 11; bcl-2-related ovarian death agonist; BIM; BOD.

Gene ID

10018

Accession Number

NP_001191035.1

Reactivity

Homo sapiens|Human

Target

Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.

Type

Protein

Source

E.coli

Sequence

MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BCL2L11

Host or Source

Human

Protein Name

Bcl-2-like protein 11

Gene Name URL

BCL2L11

Nucleotide Accession Number

NM_001204106.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)
MBS1461152-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)
MBS1461152-02 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)
MBS1461152-03 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)
MBS1461152-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)
MBS1461152-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)
MBS1461152-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus epidermidis Oxygen regulatory protein nreC (nreC)

Sign In for Pricing
View Details