Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Batf3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Basic leucine zipper ATF-like transcription factor 3

Gene Aliases

Basic leucine zipper transcription factor, ATF-like 3; basic leucine zipper transcriptional factor ATF-like 3; B-ATF-3; Jdp1; JDP-1; Jun dimerization protein 1.

Gene ID

60462

Accession Number

NP_068637.1

Reactivity

Rat|Rattus norvegicus

Target

AP-1 family transcription factor that controls the differentiation of CD8 (+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha (+) classical dendritic cells (cDCs) and related CD103 (+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Batf3

Host or Source

Rat

Protein Name

Basic leucine zipper transcriptional factor ATF-like 3

Gene Name URL

Batf3

Nucleotide Accession Number

NM_021865.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scpep1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4950208 1.0 µg DNA

Scpep1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal OPAL1 Antibody
NBP1-93988-25ul 25 µL

Rabbit Polyclonal OPAL1 Antibody

Sign In for Pricing
View Details
GAS8-AS1 (NM_001214) Human Over-expression Lysate
E45H05617-2 20 µg

GAS8-AS1 (NM_001214) Human Over-expression Lysate

Sign In for Pricing
View Details
Cd47 Mouse qPCR Primer Pair (NM_010581)
MP201932 200 Reactions

Cd47 Mouse qPCR Primer Pair (NM_010581)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) RLME Polyclonal Antibody
MBS7179092 Inquire

Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) RLME Polyclonal Antibody

Sign In for Pricing
View Details
PS2 Antibody
E51A08851 100 µL

PS2 Antibody

Sign In for Pricing
View Details