Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL4A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

ADP ribosylation factor like GTPase 4A

Gene Aliases

ADP-ribosylation factor-like 4; ADP-ribosylation factor-like 4A; ADP-ribosylation factor-like protein 4A; ARL4.

Gene ID

10124

Accession Number

NP_001032241.1

Reactivity

Homo sapiens|Human

Target

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP) . GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.

Type

Protein

Source

E.coli

Sequence

GNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ARL4A

Host or Source

Human

Protein Name

ADP-ribosylation factor-like protein 4A

Gene Name URL

ARL4A

Nucleotide Accession Number

NM_001037164.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) ART10 Polyclonal Antibody
MBS7168245 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain YJM789)(Baker's yeast) ART10 Polyclonal Antibody

Sign In for Pricing
View Details
Chemerin Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2552527 100 µL

Chemerin Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2806), CF568 conjugate, 0.1mg/mL
BNC682806-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2806), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Polyclonal APBA2 Antibody [Janelia Fluor 646]
NBP2-41127JF646 0.1 mL

Rabbit Polyclonal APBA2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Eppendorf Protein LoBind Tube 5.0 mL. Conical bottom polypropylene centrifuge tube with flip-open cap. 2 bags of 50 tubes (100) .
4011-8302 2 Bags of 50 Tubes (100)

Eppendorf Protein LoBind Tube 5.0 mL. Conical bottom polypropylene centrifuge tube with flip-open cap. 2 bags of 50 tubes (100) .

Sign In for Pricing
View Details
DnaJC13 Lentiviral Activation Particles (m)
sc-433473-LAC 200 µL

DnaJC13 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details