Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apoc3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Apolipoprotein C-III

Gene Aliases

ApoC-III; apo-CIII; apolipoprotein C3; apolipoprotein C-III.

Gene ID

11814

Accession Number

NP_001276685.1

Reactivity

Mouse|Mus musculus

Target

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Type

Protein

Source

E.coli

Sequence

EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Apoc3

Host or Source

Mouse

Protein Name

Apolipoprotein C-III

Gene Name URL

Apoc3

Nucleotide Accession Number

NM_001289756.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cofilin 1, Non Muscle (CFL1) ELISA Kit
RD-CFL1-Hu-01 96 Tests

Human Cofilin 1, Non Muscle (CFL1) ELISA Kit

Sign In for Pricing
View Details
Human Cofilin 1, Non Muscle (CFL1) ELISA Kit
RD-CFL1-Hu-02 48 Tests

Human Cofilin 1, Non Muscle (CFL1) ELISA Kit

Sign In for Pricing
View Details
MIR7150 Human qPCR Primer Pair (MI0023610)
HP301510 200 Reactions

MIR7150 Human qPCR Primer Pair (MI0023610)

Sign In for Pricing
View Details
TIPIN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E2]
TA802937AM 100 µL

TIPIN Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E2]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB614854 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
HOXA3 Mouse Monoclonal Antibody [Clone ID: OTI8C5]
CF811549 100 µg

HOXA3 Mouse Monoclonal Antibody [Clone ID: OTI8C5]

Sign In for Pricing
View Details