Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1C2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Aldo-keto reductase family 1 member C2

Gene Aliases

3-alpha-HSD3; AKR1C-pseudo; aldo-keto reductase family 1 member C2; BABP; chlordecone reductase homolog HAKRD; DD; DD/BABP; DD2; DD-2; DDH2; Dihydrodiol dehydrogenase 2; dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III; Dihydrodiol dehydrogenase/bile acid-binding protein; HAKRD; HBAB; MCDR2; pseudo-chlordecone reductase; SRXY8; TDD; testicular 17,20-desmolase deficiency; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; type II dihydrodiol dehydrogenase; Type III 3-alpha-hydroxysteroid dehydrogenase.

Gene ID

1646

Accession Number

NP_001128713.1

Reactivity

Homo sapiens|Human

Target

Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol) . Has a high bile-binding ability.

Type

Protein

Source

E.coli

Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AKR1C2

Host or Source

Human

Protein Name

Aldo-keto reductase family 1 member C2

Gene Name URL

AKR1C2

Nucleotide Accession Number

NM_001135241.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOK2 Protein Vector (Rat) (pPM-C-His)
PV264673 500 ng

DOK2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
SirT3 Rabbit mAb
F0261-100ul 100 µL

SirT3 Rabbit mAb

Sign In for Pricing
View Details
CTNNBL1 (D-2) : m-IgG Fc BP-HRP Bundle
sc-540932 1 Kit

CTNNBL1 (D-2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
MKRN2OS Recombinant Protein Antigen
NBP2-49452PEP 0.1 mL

MKRN2OS Recombinant Protein Antigen

Sign In for Pricing
View Details
AdmiRa-mmu-miR-127-3p-Off Virus
mm5083 1.0 mL

AdmiRa-mmu-miR-127-3p-Off Virus

Sign In for Pricing
View Details
SIGIRR CytoSection
TS401356P5 25 Slides

SIGIRR CytoSection

Sign In for Pricing
View Details