Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Adenylate kinase 1

Gene Aliases

Adenylate kinase isoenzyme 1; adenylate monophosphate kinase; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase 1; epididymis secretory sperm binding protein; HTL-S-58j; myokinase; testis secretory sperm binding protein Li 58j.

Gene ID

203

Accession Number

NP_000467.1

Reactivity

Homo sapiens|Human

Target

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Also displays broad nucleoside diphosphate kinase activity. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Type

Protein

Source

E.coli

Sequence

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AK1

Host or Source

Human

Protein Name

Adenylate kinase isoenzyme 1

Gene Name URL

AK1

Nucleotide Accession Number

NM_000476.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig CAT ELISA Kit
EGC0093 96 Tests

Guinea Pig CAT ELISA Kit

Sign In for Pricing
View Details
Human SETX knockdown cell line
ABC-KD13644 1 Vial

Human SETX knockdown cell line

Sign In for Pricing
View Details
Olfr341 Mouse shRNA Plasmid (Locus ID 258952)
TR514396 1 Kit

Olfr341 Mouse shRNA Plasmid (Locus ID 258952)

Sign In for Pricing
View Details
Cyclin C, CT (Cyclin-C, hSRB11, CCNC, SRB11 Homolog) (MaxLight 550)
MBS6471192-01 0.1 mL

Cyclin C, CT (Cyclin-C, hSRB11, CCNC, SRB11 Homolog) (MaxLight 550)

Sign In for Pricing
View Details
Cyclin C, CT (Cyclin-C, hSRB11, CCNC, SRB11 Homolog) (MaxLight 550)
MBS6471192-02 5x 0.1 mL

Cyclin C, CT (Cyclin-C, hSRB11, CCNC, SRB11 Homolog) (MaxLight 550)

Sign In for Pricing
View Details
CCT1 / TCP1 (1-556, His-tag) Human Protein
AR09707PU-L 250 µg

CCT1 / TCP1 (1-556, His-tag) Human Protein

Sign In for Pricing
View Details