Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIFM1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Apoptosis inducing factor mitochondria associated 1

Gene Aliases

AIF; apoptosis-inducing factor 1, mitochondrial; apoptosis-inducing factor, mitochondrion-associated, 1; auditory neuropathy, X-linked recessive 1; AUNX1; CMT2D; CMTX4; COWCK; COXPD6; DFNX5; NADMR; NAMSD; PDCD8; programmed cell death 8 (apoptosis-inducing factor) ; Programmed cell death protein 8; SEMDHL; striatal apoptosis-inducing factor; testicular secretory protein Li 4.

Gene ID

9131

Accession Number

NP_001124318.2

Reactivity

Homo sapiens|Human

Target

Functions both as NADH oxidoreductase and as regulator of apoptosis. In response to apoptotic stimuli, it is released from the mitochondrion intermembrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. In contrast, functions as an antiapoptotic factor in normal mitochondria via its NADH oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e. caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner.

Type

Protein

Source

E.coli

Sequence

GLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

71.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AIFM1

Host or Source

Human

Protein Name

Apoptosis-inducing factor 1, mitochondrial

Gene Name URL

AIFM1

Nucleotide Accession Number

NM_001130846.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDX3 ELISA Kit (Mouse)
OKEH05613-96W 96 Tests

PRDX3 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Saccharomyces cerevisiae Elp1 Rabbit Polyclonal Antibody (Fluoro594)
orb3087332 200 µL

Saccharomyces cerevisiae Elp1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
PLA2G1B, CT (PLA2G1B, PLA2, PLA2A, PPLA2, Phospholipase A2, Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B) (MaxLight 550)
MBS6334527-01 0.1 mL

PLA2G1B, CT (PLA2G1B, PLA2, PLA2A, PPLA2, Phospholipase A2, Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B) (MaxLight 550)

Sign In for Pricing
View Details
PLA2G1B, CT (PLA2G1B, PLA2, PLA2A, PPLA2, Phospholipase A2, Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B) (MaxLight 550)
MBS6334527-02 5x 0.1 mL

PLA2G1B, CT (PLA2G1B, PLA2, PLA2A, PPLA2, Phospholipase A2, Group IB phospholipase A2, Phosphatidylcholine 2-acylhydrolase 1B) (MaxLight 550)

Sign In for Pricing
View Details
Griseorhodin A
orb3023141-01 50 mg

Griseorhodin A

Sign In for Pricing
View Details
Griseorhodin A
orb3023141-02 10 mg

Griseorhodin A

Sign In for Pricing
View Details