Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGRP Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Agouti related neuropeptide

Gene Aliases

Agouti related protein homolog; agouti-related protein; AGRT; ART; ASIP2.

Gene ID

181

Accession Number

NP_001129.1

Reactivity

Homo sapiens|Human

Target

Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R (By similarity) . Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.

Type

Protein

Source

E.coli

Sequence

AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

28.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AGRP

Host or Source

Human

Protein Name

Agouti-related protein

Gene Name URL

AGRP

Nucleotide Accession Number

NM_001138.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)
MBS2005213-01 0.1 mL

Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)
MBS2005213-02 0.2 mL

Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)
MBS2005213-03 0.5 mL

Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)
MBS2005213-04 1 mL

Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)
MBS2005213-05 5 mL

Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)
MBS2005213-06 5x 5 mL

Biotin-Linked Antibody to Cytochrome P450 2D6 (CYP2D6)

Sign In for Pricing
View Details