Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADD Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Adenosine deaminase

Gene Aliases

Adenosine aminohydrolase; adenosine deaminase; b1623; ECK1618.

Gene ID

945851

Accession Number

NP_416140.1

Reactivity

Escherichia coli

Target

Binds TrxA (Kumar, 2004) . [More information is available at EcoGene: EG10030].

Type

Protein

Source

E.coli

Sequence

MIDTTLPLTDIHRHLDGNIRPQTILELGRQYNISLPAQSLETLIPHVQVIANEPDLVSFLTKLDWGVKVLASLDACRRVAFENIEDAARHGLHYVELRFSPGYMAMAHQLPVAGVVEAVIDGVREGCRTFGVQAKLIGIMSRTFGEAACQQELEAFLAHRDQITALDLAGDELGFPGSLFLSHFNRARDAGWHITVHAGEAAGPESIWQAIRELGAERIGHGVKAIEDRALMDFLAEQQIGIESCLTSNIQTSTVAELAAHPLKTFLEHGIRASINTDDPGVQGVDIIHEYTVAAPAAGLSREQIRQAQINGLEMAFLSAEEKRALREKVAAK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Add

Host or Source

Escherichia coli

Protein Name

Adenosine deaminase

Gene Name URL

Add

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMCO6 Peptide - N-terminal region (AAP57272)
AAP57272-100UG 100 µg

TMCO6 Peptide - N-terminal region (AAP57272)

Sign In for Pricing
View Details
GalNAc-T6 shRNA Plasmid (m)
sc-75101-SH 20 µg

GalNAc-T6 shRNA Plasmid (m)

Sign In for Pricing
View Details
PrP (Prion Protein, Prion, CD230, Cluster of Differentiation 230) (FITC)
MBS6453338-01 0.1 mL

PrP (Prion Protein, Prion, CD230, Cluster of Differentiation 230) (FITC)

Sign In for Pricing
View Details
PrP (Prion Protein, Prion, CD230, Cluster of Differentiation 230) (FITC)
MBS6453338-02 5x 0.1 mL

PrP (Prion Protein, Prion, CD230, Cluster of Differentiation 230) (FITC)

Sign In for Pricing
View Details
PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 405) discontinued
131504-ML405 100 µL

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Olr1413 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV635675 1.0 µg DNA

Olr1413 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details