Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Scavenger receptor cysteine-rich type 1 protein M130

Product Specifications

CAS Number

9000-83-3

Gene Name

CD163 antigen

Gene Aliases

CD163v2; CD163v3; scavenger receptor cysteine-rich type 1 protein M130.

Gene ID

93671

Reactivity

Mouse|Mus musculus

Target

Involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 (By similarity) .

Type

Protein

Source

Yeast

Sequence

VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cd163

Protein Name

Scavenger receptor cysteine-rich type 1 protein M130

Gene Name URL

Cd163

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNA1 (NM_001039523) Human Tagged Lenti ORF Clone
RC221168L1 10 µg

CHRNA1 (NM_001039523) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Edwardsiella tarda (E. tarda) (MaxLight 405)
MBS6252794-01 0.1 mL

Edwardsiella tarda (E. tarda) (MaxLight 405)

Sign In for Pricing
View Details
Edwardsiella tarda (E. tarda) (MaxLight 405)
MBS6252794-02 5x 0.1 mL

Edwardsiella tarda (E. tarda) (MaxLight 405)

Sign In for Pricing
View Details
YSK Antibody (C-term)
MBS9203593-01 0.08 mL

YSK Antibody (C-term)

Sign In for Pricing
View Details
YSK Antibody (C-term)
MBS9203593-02 0.4 mL

YSK Antibody (C-term)

Sign In for Pricing
View Details
YSK Antibody (C-term)
MBS9203593-03 5x 0.4 mL

YSK Antibody (C-term)

Sign In for Pricing
View Details