Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hemoglobin subunit beta-2

Product Specifications

CAS Number

9000-83-3

Gene Name

Hemoglobin, beta adult minor chain

Gene Aliases

AI036344; beta min; beta minor globin; beta2; Beta-2-globin; Hbb2; Hbbt2; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain; hemoglobin subunit beta-2.

Gene ID

15130

Reactivity

Mouse|Mus musculus

Target

Involved in oxygen transport from the lung to the various peripheral tissues.

Type

Protein

Source

Yeast

Sequence

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Hbb-b2

Protein Name

Hemoglobin subunit beta-2

Gene Name URL

Hbb-b2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S100 Calcium Binding Protein A5 (S100A5) ELISA Kit
RDR-S100A5-Hu-01 96 Tests

Human S100 Calcium Binding Protein A5 (S100A5) ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein A5 (S100A5) ELISA Kit
RDR-S100A5-Hu-02 48 Tests

Human S100 Calcium Binding Protein A5 (S100A5) ELISA Kit

Sign In for Pricing
View Details
C9orf98 Polyclonal Antibody, Cy3 Conjugated
bs-15351R-Cy3 100 µL

C9orf98 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
6-Amino-4-hydroxyquinoline-2-carboxylic acid
437841-01 100 mg

6-Amino-4-hydroxyquinoline-2-carboxylic acid

Sign In for Pricing
View Details
6-Amino-4-hydroxyquinoline-2-carboxylic acid
437841-02 250 mg

6-Amino-4-hydroxyquinoline-2-carboxylic acid

Sign In for Pricing
View Details
Vcan ORF Vector (Rat) (pORF)
ORF078772 1.0 µg DNA

Vcan ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details