Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Carboxylesterase 1C

Product Specifications

CAS Number

9000-83-3

Gene Name

Carboxylesterase 1C

Gene Aliases

Carboxylesterase 1C; Ces; Ces-N; Ee1; Ee-1; Es; Es-; Es1; Es4; Es-4; EsN; Es-N; esterase 1; liver carboxylesterase N; lung surfactant convertase; PESN; PES-N.

Gene ID

13884

Reactivity

Mouse|Mus musculus

Target

Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.

Type

Protein

Source

Yeast

Sequence

HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ces1c

Protein Name

Carboxylesterase 1C

Gene Name URL

Ces1c

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine serum albumin (BSA) protein (>99%, Protease & IgG-free; Low endotoxin; Diagnostic grade)
BSA17-N-10G 10 g

Bovine serum albumin (BSA) protein (>99%, Protease & IgG-free; Low endotoxin; Diagnostic grade)

Sign In for Pricing
View Details
COG2 Peptide
MBS3236828-01 0.1 mg

COG2 Peptide

Sign In for Pricing
View Details
COG2 Peptide
MBS3236828-02 5x 0.1 mg

COG2 Peptide

Sign In for Pricing
View Details
Dengue NS1 Protein - Type 2
30-2100 1 mg

Dengue NS1 Protein - Type 2

Sign In for Pricing
View Details
ALDH3A1 (NM_000691) Human Tagged Lenti ORF Clone
RC202440L3 10 µg

ALDH3A1 (NM_000691) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZCCHC6 CRISPRa sgRNA lentivector (set of three targets)(Human)
50769121 3x 1.0µg DNA

ZCCHC6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details