Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Transcription cofactor vestigial-like protein 3

Product Specifications

CAS Number

9000-83-3

Gene Name

Vestigial like family member 3

Gene Aliases

Colon carcinoma related protein; transcription cofactor vestigial-like protein 3; VGL3; VGL-3.

Gene ID

389136

Reactivity

Homo sapiens|Human

Target

May act as a specific coactivator for the mammalian TEFs.

Type

Protein

Source

Yeast

Sequence

MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VGLL3

Protein Name

Transcription cofactor vestigial-like protein 3

Gene Name URL

VGLL3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cecum
CS808521 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
Chymotrypsin Activity Colorimetric Assay Kit
E-BC-K845-M-01 48 T (32 samples)

Chymotrypsin Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Chymotrypsin Activity Colorimetric Assay Kit
E-BC-K845-M-02 96 T (80 samples)

Chymotrypsin Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
(±)-2-Pentanol
TRC-P227105-250ML 250 mL

(±)-2-Pentanol

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF568 conjugate, 0.1mg/mL
BNC682037-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human ROR1 Protein (ECD, His Tag)
PKSH030440-01 100 µg

Recombinant Human ROR1 Protein (ECD, His Tag)

Sign In for Pricing
View Details