What is the catalog number for Recombinant Mouse Superoxide dismutase [Cu-Zn]?

The catalog number for Recombinant Mouse Superoxide dismutase [Cu-Zn] is OPCA01306-1MG.

What sizes are available for Recombinant Mouse Superoxide dismutase [Cu-Zn]?

Recombinant Mouse Superoxide dismutase [Cu-Zn] is available in the following size(s): 1 mg.

Is Recombinant Mouse Superoxide dismutase [Cu-Zn] in stock?

Recombinant Mouse Superoxide dismutase [Cu-Zn] is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Mouse Superoxide dismutase [Cu-Zn]

Product Specifications

CAS Number

9000-83-3

Gene Name

Superoxide dismutase 1, soluble

Gene Aliases

B430204E11Rik; Cu (2+) -Zn2+ superoxide dismutase; Cu/Zn-; Cu/Zn-SOD; CuZn; CuZnSOD; I; Ip; Ipo1; Ipo-1; SO; Sod; Sod-1; SODC; superoxide dismutase [Cu-Zn].

Gene ID

20655

Reactivity

Mouse|Mus musculus

Target

Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Type

Protein

Source

Yeast

Sequence

AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.