Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Ropporin-1B

Product Specifications

CAS Number

9000-83-3

Gene Name

Rhophilin associated tail protein 1B

Gene Aliases

AKAP-binding sperm protein ropporin; rhophilin-associated protein 1B; ropporin, rhophilin associated protein 1B; ropporin-1B; testis tissue sperm-binding protein Li 83P.

Gene ID

152015

Reactivity

Homo sapiens|Human

Target

Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.

Type

Protein

Source

Yeast

Sequence

MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ROPN1B

Protein Name

Ropporin-1B

Gene Name URL

ROPN1B

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CCL19/MIP-3 beta Antibody (OTI2A12) [Alexa Fluor 594]
NBP2-71278AF594 0.1 mL

Mouse Monoclonal CCL19/MIP-3 beta Antibody (OTI2A12) [Alexa Fluor 594]

Sign In for Pricing
View Details
rMIP 1a
chm-343 5µg

rMIP 1a

Sign In for Pricing
View Details
LGALS3BP Rabbit Polyclonal Antibody (Cy3)
orb2581849 100 µg

LGALS3BP Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
ARID1B siRNA Oligos set (Human)
12352171 3x 5 nmol

ARID1B siRNA Oligos set (Human)

Sign In for Pricing
View Details
Alanine Aminotransferase 1 / ALT (GPT) Antibody
abx214488-01 50 µL

Alanine Aminotransferase 1 / ALT (GPT) Antibody

Sign In for Pricing
View Details
Alanine Aminotransferase 1 / ALT (GPT) Antibody
abx214488-02 100 µL

Alanine Aminotransferase 1 / ALT (GPT) Antibody

Sign In for Pricing
View Details