Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human RING-box protein 2

Product Specifications

CAS Number

9000-83-3

Gene Name

Ring finger protein 7

Gene Aliases

CKBBP1; CKII beta-binding protein 1; rbx2; regulator of cullins 2; RING finger protein 7; RING-box protein 2; ROC2; SAG; sensitive to apoptosis gene protein; sensitive to apoptosis, zinc RING finger protein SAG, regulator of cullins 2; zinc RING finger protein SAG.

Gene ID

9616

Reactivity

Homo sapiens|Human

Target

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed:10851089) . CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity) . Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.

Type

Protein

Source

Yeast

Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RNF7

Protein Name

RING-box protein 2

Gene Name URL

RNF7

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat GFRA4 shRNA Plasmid
abx986457-01 150 µg

Rat GFRA4 shRNA Plasmid

Sign In for Pricing
View Details
Rat GFRA4 shRNA Plasmid
abx986457-02 300 µg

Rat GFRA4 shRNA Plasmid

Sign In for Pricing
View Details
4-O-Galloylalbiflorin
MBS5824960 Inquire

4-O-Galloylalbiflorin

Sign In for Pricing
View Details
CalmoduLin (CALM2) (NM_001743) Human Recombinant Protein
TP304796 20 µg

CalmoduLin (CALM2) (NM_001743) Human Recombinant Protein

Sign In for Pricing
View Details
PGBD2 (NM_001017434) Human Untagged Clone
SC302053 10 µg

PGBD2 (NM_001017434) Human Untagged Clone

Sign In for Pricing
View Details
PA2G4 Polyclonal Antibody
ANT-13636-50ug 50 µg

PA2G4 Polyclonal Antibody

Sign In for Pricing
View Details