Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prostate stem cell antigen

Product Specifications

CAS Number

9000-83-3

Gene Name

Prostate stem cell antigen

Gene Aliases

2210408B04Rik; prostate stem cell antigen.

Gene ID

72373

Reactivity

Mouse|Mus musculus

Target

May be involved in the regulation of cell proliferation.

Type

Protein

Source

Yeast

Sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

10.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Psca

Protein Name

Prostate stem cell antigen

Gene Name URL

Psca

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT21 Conjugated Antibody
orb1617337 100 µL

NUDT21 Conjugated Antibody

Sign In for Pricing
View Details
Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol
EDA27903-01 1 mg

Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol

Sign In for Pricing
View Details
Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol
EDA27903-02 5 mg

Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol

Sign In for Pricing
View Details
Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol
EDA27903-03 10 mg

Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol

Sign In for Pricing
View Details
Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol
EDA27903-04 25 mg

Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol

Sign In for Pricing
View Details
Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol
EDA27903-05 50 mg

Acrylfentanyl hydrochloride - 1 mg/ml solution in methanol

Sign In for Pricing
View Details