Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human 14 kDa phosphohistidine phosphatase

Product Specifications

CAS Number

9000-83-3

Gene Name

Phosphohistidine phosphatase 1

Gene Aliases

14 kDa phosphohistidine phosphatase; CGI-202; epididymis secretory sperm binding protein Li 132P; HEL-S-132P; HSPC141; Phosphohistidine phosphatase 1; PHP; PHP14; protein histidine phosphatase; protein janus-A homolog; sex-regulated protein janus-a.

Gene ID

29085

Reactivity

Homo sapiens|Human

Target

Exhibits phosphohistidine phosphatase activity.

Type

Protein

Source

Yeast

Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHPT1

Protein Name

14 kDa phosphohistidine phosphatase

Gene Name URL

PHPT1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIN2C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0907008 1.0 µg DNA

GRIN2C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Fzd9 qPCR Primer Pair
QM13418S 200 Tests

Mouse Fzd9 qPCR Primer Pair

Sign In for Pricing
View Details
TRIM29 Rabbit mAb
56666 50 µL

TRIM29 Rabbit mAb

Sign In for Pricing
View Details
Ubxn2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6516005 3x 1.0 µg

Ubxn2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Nephroselmis olivacea Photosystem I P700 chlorophyll a apoprotein A1 (psaA), partial
MBS7101607 Inquire

Recombinant Nephroselmis olivacea Photosystem I P700 chlorophyll a apoprotein A1 (psaA), partial

Sign In for Pricing
View Details
Pyridine 99.5% AR
02223 00500 500 mL

Pyridine 99.5% AR

Sign In for Pricing
View Details