Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human 14 kDa phosphohistidine phosphatase

Product Specifications

CAS Number

9000-83-3

Gene Name

Phosphohistidine phosphatase 1

Gene Aliases

14 kDa phosphohistidine phosphatase; CGI-202; epididymis secretory sperm binding protein Li 132P; HEL-S-132P; HSPC141; Phosphohistidine phosphatase 1; PHP; PHP14; protein histidine phosphatase; protein janus-A homolog; sex-regulated protein janus-a.

Gene ID

29085

Reactivity

Homo sapiens|Human

Target

Exhibits phosphohistidine phosphatase activity.

Type

Protein

Source

Yeast

Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHPT1

Protein Name

14 kDa phosphohistidine phosphatase

Gene Name URL

PHPT1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC14A Human Over-expression Lysate
orb1351994 100 µg

CDC14A Human Over-expression Lysate

Sign In for Pricing
View Details
Mmu-let-7a-5p miRNA Agomir
orb1918863-01 5 nmol

Mmu-let-7a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-let-7a-5p miRNA Agomir
orb1918863-02 10 nmol

Mmu-let-7a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-let-7a-5p miRNA Agomir
orb1918863-03 20 nmol

Mmu-let-7a-5p miRNA Agomir

Sign In for Pricing
View Details
GPER1 Knockout 143B Polyclonal Cells
ARG35045 1 Million

GPER1 Knockout 143B Polyclonal Cells

Sign In for Pricing
View Details
12-Deoxy Roxithromycin-d7
411915-01 1 mg

12-Deoxy Roxithromycin-d7

Sign In for Pricing
View Details