Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Pterin-4-alpha-carbinolamine dehydratase

Product Specifications

CAS Number

9000-83-3

Gene Name

Pterin-4 alpha-carbinolamine dehydratase 1

Gene Aliases

4-alpha-hydroxy-tetrahydropterin dehydratase;6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) ; DCOH; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; dimerizing cofactor for HNF1; PCBD; PCD; phenylalanine hydroxylase-stimulating protein; PHS; Pterin carbinolamine dehydratase; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; pterin-4-alpha-carbinolamine dehydratase.

Gene ID

5092

Reactivity

Homo sapiens|Human

Target

Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.

Type

Protein

Source

Yeast

Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PCBD1

Protein Name

Pterin-4-alpha-carbinolamine dehydratase

Gene Name URL

PCBD1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm715 siRNA (m)
sc-145598 10 µM

Gm715 siRNA (m)

Sign In for Pricing
View Details
Guinea Pig Xin actin binding repeat containing protein 1 (XIRP1) ELISA Kit
GTR10348773 96 Well

Guinea Pig Xin actin binding repeat containing protein 1 (XIRP1) ELISA Kit

Sign In for Pricing
View Details
Phospho-IKK beta (Ser466) Rabbit Polyclonal Antibody (BF680)
orb1816584 100 µL

Phospho-IKK beta (Ser466) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
IMMT Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV662286 1.0 µg DNA

IMMT Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
YME1 Antibody
orb850762 2 mg

YME1 Antibody

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida fbp Protein (aa 1-333)
VAng-Cr6805-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida fbp Protein (aa 1-333)

Sign In for Pricing
View Details