Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Pterin-4-alpha-carbinolamine dehydratase

Product Specifications

CAS Number

9000-83-3

Gene Name

Pterin-4 alpha-carbinolamine dehydratase 1

Gene Aliases

4-alpha-hydroxy-tetrahydropterin dehydratase;6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) ; DCOH; Dimerization cofactor of hepatocyte nuclear factor 1-alpha; dimerizing cofactor for HNF1; PCBD; PCD; phenylalanine hydroxylase-stimulating protein; PHS; Pterin carbinolamine dehydratase; pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha; pterin-4-alpha-carbinolamine dehydratase.

Gene ID

5092

Reactivity

Homo sapiens|Human

Target

Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity.

Type

Protein

Source

Yeast

Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PCBD1

Protein Name

Pterin-4-alpha-carbinolamine dehydratase

Gene Name URL

PCBD1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TSPAN3 sgRNA gene knockout kit - Lentiviral human TSPAN3 sgRNA gene knockout kit (25)
GTR15367092 1 Vial

Lentiviral human TSPAN3 sgRNA gene knockout kit - Lentiviral human TSPAN3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Lentiviral human CBX5 sgRNA gene knockout kit - Lentiviral human CBX5 sgRNA gene knockout kit (25)
GTR15388326 1 Vial

Lentiviral human CBX5 sgRNA gene knockout kit - Lentiviral human CBX5 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit
MBS9941778-01 48 Well

Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit

Sign In for Pricing
View Details
Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit
MBS9941778-02 96 Well

Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit

Sign In for Pricing
View Details
Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit
MBS9941778-03 5x 96 Well

Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit

Sign In for Pricing
View Details
Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit
MBS9941778-04 10x 96 Well

Sheep Transcription Regulator Protein BACH1 (BACH1) ELISA Kit

Sign In for Pricing
View Details