Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human protein BEX3

Product Specifications

CAS Number

9000-83-3

Gene Name

Brain expressed X-linked 3

Gene Aliases

Bex; brain-expressed X-linked protein 3; DXS6984E; HGR74; NADE; nerve growth factor receptor (TNFRSF16) associated protein 1; Nerve growth factor receptor-associated protein 1; NGFRAP1; ovarian granulosa cell 13.0 kDa protein HGR74; p75NTR-associated cell death executor; protein BEX3.

Gene ID

27018

Reactivity

Homo sapiens|Human

Target

May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity) . May play an important role in the pathogenesis of neurogenetic diseases.

Type

Protein

Source

Yeast

Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BEX3

Protein Name

Protein BEX3

Gene Name URL

BEX3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MG Polyclonal Antibody, APC Conjugated
bs-1676R-APC 100 µL

MG Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Nicastrin Antibody [DyLight 405]
NBP1-77270V 0.1 mL

Rabbit Polyclonal Nicastrin Antibody [DyLight 405]

Sign In for Pricing
View Details
PPIL1 Lentiviral Activation Particles (h)
sc-412231-LAC 200 µL

PPIL1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Hipk2 sgRNA CRISPR Lentivector set (Rat)
K6392301 3x 1.0 µg

Hipk2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal SRPRB Antibody (OTI1D9) [DyLight 680]
NBP2-74350FR 0.1 mL

Mouse Monoclonal SRPRB Antibody (OTI1D9) [DyLight 680]

Sign In for Pricing
View Details
Mouse monoclonal ANXA6 antibody
MBS5305166 Inquire

Mouse monoclonal ANXA6 antibody

Sign In for Pricing
View Details