Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human protein BEX3

Product Specifications

CAS Number

9000-83-3

Gene Name

Brain expressed X-linked 3

Gene Aliases

Bex; brain-expressed X-linked protein 3; DXS6984E; HGR74; NADE; nerve growth factor receptor (TNFRSF16) associated protein 1; Nerve growth factor receptor-associated protein 1; NGFRAP1; ovarian granulosa cell 13.0 kDa protein HGR74; p75NTR-associated cell death executor; protein BEX3.

Gene ID

27018

Reactivity

Homo sapiens|Human

Target

May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity) . May play an important role in the pathogenesis of neurogenetic diseases.

Type

Protein

Source

Yeast

Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BEX3

Protein Name

Protein BEX3

Gene Name URL

BEX3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD1LG2 Human, Sf9
32-13359-10 10 µg

PDCD1LG2 Human, Sf9

Sign In for Pricing
View Details
GS Homeobox 2 (GSX2) Antibody (Biotin)
abx343062-01 20 µg

GS Homeobox 2 (GSX2) Antibody (Biotin)

Sign In for Pricing
View Details
GS Homeobox 2 (GSX2) Antibody (Biotin)
abx343062-02 50 µg

GS Homeobox 2 (GSX2) Antibody (Biotin)

Sign In for Pricing
View Details
GS Homeobox 2 (GSX2) Antibody (Biotin)
abx343062-03 100 µg

GS Homeobox 2 (GSX2) Antibody (Biotin)

Sign In for Pricing
View Details
GS Homeobox 2 (GSX2) Antibody (Biotin)
abx343062-04 200 µg

GS Homeobox 2 (GSX2) Antibody (Biotin)

Sign In for Pricing
View Details
GS Homeobox 2 (GSX2) Antibody (Biotin)
abx343062-05 1 mg

GS Homeobox 2 (GSX2) Antibody (Biotin)

Sign In for Pricing
View Details