What is the catalog number for Recombinant human Mannose-binding protein C?

The catalog number for Recombinant human Mannose-binding protein C is OPCA01272-100UG.

What sizes are available for Recombinant human Mannose-binding protein C?

Recombinant human Mannose-binding protein C is available in the following size(s): 100 µg.

Is Recombinant human Mannose-binding protein C in stock?

Recombinant human Mannose-binding protein C is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Mannose-binding protein C

Product Specifications

CAS Number

9000-83-3

Gene Name

Mannose binding lectin 2

Gene Aliases

COLEC1; collectin-1; HSMBPC; mannan-binding lectin; Mannan-binding protein; Mannose-binding lectin; mannose-binding lectin (protein C) 2, soluble (opsonic defect) ; mannose-binding lectin 2, soluble (opsonic defect) ; mannose-binding protein C; MBL; MBL2D; MBP; MBP1; MBP-C; MBPD.

Gene ID

4153

Reactivity

Homo sapiens|Human

Target

Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Type

Protein

Source

Yeast

Sequence

ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.