Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Lymphocyte antigen 6 complex locus protein G6d

Product Specifications

CAS Number

9000-83-3

Gene Name

Lymphocyte antigen 6 family member G6D

Gene Aliases

C6orf23; G6D; LY6-D; lymphocyte antigen 6 complex locus protein G6d; lymphocyte antigen 6 complex, locus G6D; lymphocyte antigen-6 G6D; megakaryocyte-enhanced gene transcript 1 protein; MEGT1; NG25; protein Ly6-D.

Gene ID

58530

Reactivity

Homo sapiens|Human

Target

Recombinant human Lymphocyte antigen 6 complex locus protein G6d

Type

Protein

Source

Yeast

Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Lyophilized

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LY6G6D

Protein Name

Lymphocyte antigen 6 complex locus protein G6d

Gene Name URL

LY6G6D

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WD Repeat-Containing Protein 16 (WDR16) Antibody
abx122280-01 100 µg

WD Repeat-Containing Protein 16 (WDR16) Antibody

Sign In for Pricing
View Details
WD Repeat-Containing Protein 16 (WDR16) Antibody
abx122280-02 1 mg

WD Repeat-Containing Protein 16 (WDR16) Antibody

Sign In for Pricing
View Details
Recombinant Thiobacillus denitrificans Biotin synthase (bioB)
MBS1321432-01 0.02 mg (E-Coli)

Recombinant Thiobacillus denitrificans Biotin synthase (bioB)

Sign In for Pricing
View Details
Recombinant Thiobacillus denitrificans Biotin synthase (bioB)
MBS1321432-02 0.02 mg (Yeast)

Recombinant Thiobacillus denitrificans Biotin synthase (bioB)

Sign In for Pricing
View Details
Recombinant Thiobacillus denitrificans Biotin synthase (bioB)
MBS1321432-03 0.1 mg (E-Coli)

Recombinant Thiobacillus denitrificans Biotin synthase (bioB)

Sign In for Pricing
View Details
Recombinant Thiobacillus denitrificans Biotin synthase (bioB)
MBS1321432-04 0.1 mg (Yeast)

Recombinant Thiobacillus denitrificans Biotin synthase (bioB)

Sign In for Pricing
View Details