Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant sheep Interleukin-6

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 6

Gene Aliases

IL-6; interleukin 6 (interferon, beta 2) ; interleukin-6.

Gene ID

443406

Reactivity

Ovis aries|Sheep

Target

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T (H) 17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity) .

Type

Protein

Source

Yeast

Sequence

GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL6

Protein Name

Interleukin-6

Gene Name URL

IL6

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csnk1a1 Peptide - N-terminal region
MBS3235422-01 0.1 mg

Csnk1a1 Peptide - N-terminal region

Sign In for Pricing
View Details
Csnk1a1 Peptide - N-terminal region
MBS3235422-02 5x 0.1 mg

Csnk1a1 Peptide - N-terminal region

Sign In for Pricing
View Details
Research Grade Dezamizumab
DHC00101 100 μg

Research Grade Dezamizumab

Sign In for Pricing
View Details
Primary Rat Auricular Chondrocytes (ACC)
TRV-0018628 5x 10^5 Cells

Primary Rat Auricular Chondrocytes (ACC)

Sign In for Pricing
View Details
Mouse Polyclonal CDC20B Antibody
H00166979-B01P 0.05 mg

Mouse Polyclonal CDC20B Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD44 Antibody (691534) [PerCP]
FAB7045C 0.1 mL

Mouse Monoclonal CD44 Antibody (691534) [PerCP]

Sign In for Pricing
View Details