What is the catalog number for Recombinant Mouse Hemoglobin subunit alpha?

The catalog number for Recombinant Mouse Hemoglobin subunit alpha is OPCA01245-100UG.

What sizes are available for Recombinant Mouse Hemoglobin subunit alpha?

Recombinant Mouse Hemoglobin subunit alpha is available in the following size(s): 100 µg.

Is Recombinant Mouse Hemoglobin subunit alpha in stock?

Recombinant Mouse Hemoglobin subunit alpha is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Mouse Hemoglobin subunit alpha

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Alpha-globin; Hemoglobin alpha chain.

Reactivity

Mouse|Mus musculus

Target

Involved in oxygen transport from the lung to the various peripheral tissues.

Type

Protein

Source

Yeast

Sequence

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.