Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Glycophorin-A

Product Specifications

CAS Number

9000-83-3

Gene Name

Glycophorin A (MNS blood group)

Gene Aliases

CD235a; erythroid-lineage-specific membrane sialoglycoprotein; glycophorin A (MN blood group) ; glycophorin A, GPA; glycophorin Erik; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Sta type C; glycophorin-A; GPA; GPErik; GPSAT; HGpMiV; HGpMiXI; HGpSta (C) ; Mi.V glycoprotein (24 AA) ; MN; MN sialoglycoprotein; MNS; PAS-2; recombinant glycophorin A-B Miltenberger-DR; sialoglycoprotein alpha.

Gene ID

2993

Reactivity

Homo sapiens|Human

Target

Recombinant human Glycophorin-A

Type

Protein

Source

Yeast

Sequence

LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

9.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GYPA

Protein Name

Glycophorin

Gene Name URL

GYPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GnRH (GNRH1) activation kit by CRISPRa
GA101866 1 Kit

Human GnRH (GNRH1) activation kit by CRISPRa

Sign In for Pricing
View Details
TAS2R3 Rabbit Polyclonal Antibody (FITC)
orb2088102 100 µL

TAS2R3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
RGD1562344 Protein Vector (Rat) (pPM-C-HA)
PV300524 500 ng

RGD1562344 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human F8A2 activation kit by CRISPRa
GA118572 1 Kit

Human F8A2 activation kit by CRISPRa

Sign In for Pricing
View Details
Lithium tetrakis (pentafluorophenyl) borate ethyl etherate
GW7003-10g 10 g

Lithium tetrakis (pentafluorophenyl) borate ethyl etherate

Sign In for Pricing
View Details
Mouse Ankrd37 (NM_001039562) AAV Particle
MR201222A1V 250 µL

Mouse Ankrd37 (NM_001039562) AAV Particle

Sign In for Pricing
View Details