Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Glucagon-like peptide 1 receptor

Product Specifications

CAS Number

9000-83-3

Gene Name

Glucagon like peptide 1 receptor

Gene Aliases

GLP-1; GLP1 receptor; GLP-1 receptor; GLP-1R; GLP-1-R; glucagon-like peptide 1 receptor; seven transmembrane helix receptor.

Gene ID

2740

Reactivity

Homo sapiens|Human

Target

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449) . Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449) . Plays a role in regulating insulin secretion in response to GLP-1 (By similarity) .

Type

Protein

Source

Yeast

Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Purification

Affinity purified using IMAC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.1-5 mg/ml (Bradford method)

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GLP1R

Protein Name

Glucagon-like peptide 1 receptor

Gene Name URL

GLP1R

More Discoveries

Explore Other Products

Browse additional items from our catalog

HN1 (Hematological and Neurological Expressed 1, ARM2, HN1A)
247160 100 µg

HN1 (Hematological and Neurological Expressed 1, ARM2, HN1A)

Sign In for Pricing
View Details
SLC35B1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV695983 1.0 µg DNA

SLC35B1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (MaxLight 490)
MBS6209204-01 0.1 mL

TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (MaxLight 490)

Sign In for Pricing
View Details
TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (MaxLight 490)
MBS6209204-02 5x 0.1 mL

TUBB2A (Tubulin, beta 2A, TUBB, TUBB2, dJ40E16.7) (MaxLight 490)

Sign In for Pricing
View Details
Anti-RGS8 Antibody (R3N71)
RHF24101 100 μg

Anti-RGS8 Antibody (R3N71)

Sign In for Pricing
View Details
Human CDK14 qPCR Primer Pair
QH19969S 200 Tests

Human CDK14 qPCR Primer Pair

Sign In for Pricing
View Details