Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Glucagon-like peptide 1 receptor

Product Specifications

CAS Number

9000-83-3

Gene Name

Glucagon like peptide 1 receptor

Gene Aliases

GLP-1; GLP1 receptor; GLP-1 receptor; GLP-1R; GLP-1-R; glucagon-like peptide 1 receptor; seven transmembrane helix receptor.

Gene ID

2740

Reactivity

Homo sapiens|Human

Target

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449) . Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels (PubMed:8405712, PubMed:8216285, PubMed:7517895, PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449) . Plays a role in regulating insulin secretion in response to GLP-1 (By similarity) .

Type

Protein

Source

Yeast

Sequence

RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Purification

Affinity purified using IMAC.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.1-5 mg/ml (Bradford method)

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GLP1R

Protein Name

Glucagon-like peptide 1 receptor

Gene Name URL

GLP1R

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ints12 Pre-designed siRNA Set B
SI106747B 1 Each

Mouse Ints12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rnft2 (NM_172998) Mouse Tagged Lenti ORF Clone
MR205411L3 10 µg

Rnft2 (NM_172998) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Erythropoietin (EPO) Antibody
abx131863-01 100 µL

Erythropoietin (EPO) Antibody

Sign In for Pricing
View Details
Erythropoietin (EPO) Antibody
abx131863-02 200 µL

Erythropoietin (EPO) Antibody

Sign In for Pricing
View Details
Erythropoietin (EPO) Antibody
abx131863-03 1 mL

Erythropoietin (EPO) Antibody

Sign In for Pricing
View Details
Human BTG1 Knockout A549 cell line
GTR15416197 1 Vial

Human BTG1 Knockout A549 cell line

Sign In for Pricing
View Details