What is the catalog number for Recombinant rat Collagen alpha-1 (I) chain?

The catalog number for Recombinant rat Collagen alpha-1 (I) chain is OPCA01224-100UG.

What sizes are available for Recombinant rat Collagen alpha-1 (I) chain?

Recombinant rat Collagen alpha-1 (I) chain is available in the following size(s): 100 µg.

Is Recombinant rat Collagen alpha-1 (I) chain in stock?

Recombinant rat Collagen alpha-1 (I) chain is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant rat Collagen alpha-1 (I) chain

Product Specifications

CAS Number

9000-83-3

Gene Name

Collagen type I alpha 1 chain

Gene Aliases

Alpha-1 type I collagen; COLIA1; collagen alpha-1 (I) chain; collagen, type 1, alpha 1; collagen, type I, alpha 1; procollagen type I, alpha 1; procollagen, type 1, alpha 1; type I-alpha 1 collagen.

Gene ID

29393

Reactivity

Rat|Rattus norvegicus

Target

Type I collagen is a member of group I collagen (fibrillar forming collagen) .

Type

Protein

Source

Yeast

Sequence

QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.