Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit CD40 ligand

Product Specifications

CAS Number

9000-83-3

Gene Name

CD40 ligand

Gene Aliases

CD40 ligand; TNLG8B; tumor necrosis factor ligand 8B; Tumor necrosis factor ligand superfamily member 5.

Gene ID

100358388

Reactivity

Oryctolagus cuniculus|Rabbit

Target

Cytokine that binds to CD40/TNFRSF5. Involved in immunoglobulin class switching.

Type

Protein

Source

Yeast

Sequence

MQKGDQDPQIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSNQEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVNVTDASQVNHGTGFTSFGLLKL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CD40LG

Protein Name

CD40 ligand

Gene Name URL

CD40LG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)
MBS1300501-01 0.02 mg (E-Coli)

Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)
MBS1300501-02 0.1 mg (E-Coli)

Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)
MBS1300501-03 0.02 mg (Yeast)

Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)
MBS1300501-04 0.1 mg (Yeast)

Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)
MBS1300501-05 0.02 mg (Baculovirus)

Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details
Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)
MBS1300501-06 0.02 mg (Mammalian-Cell)

Recombinant Idiomarina loihiensis RNA pyrophosphohydrolase (rppH)

Sign In for Pricing
View Details