Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant rat Carbonic anhydrase 1

Product Specifications

CAS Number

9000-83-3

Gene Name

Carbonic anhydrase 1

Gene Aliases

Ca1; CA-I; Carbonate dehydratase I; carbonic anhydrase 1; carbonic anhydrase I.

Gene ID

310218

Reactivity

Rat|Rattus norvegicus

Target

Reversible hydration of carbon dioxide.

Type

Protein

Source

Yeast

Sequence

ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Car1

Protein Name

Carbonic anhydrase 1

Gene Name URL

Car1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf86 Human Gene Knockout Kit (CRISPR)
KN426971 1 Kit

C11orf86 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC22A20 siRNA (Mouse)
MBS8211727-01 15 nmol

SLC22A20 siRNA (Mouse)

Sign In for Pricing
View Details
SLC22A20 siRNA (Mouse)
MBS8211727-02 30 nmol

SLC22A20 siRNA (Mouse)

Sign In for Pricing
View Details
SLC22A20 siRNA (Mouse)
MBS8211727-03 5x 30 nmol

SLC22A20 siRNA (Mouse)

Sign In for Pricing
View Details
LC3C Antibody (MAP1LC3C)
F46128-0.4ML 0.4 mL

LC3C Antibody (MAP1LC3C)

Sign In for Pricing
View Details
APG4B, ID (G254) (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (MaxLight 650) discontinued
031962-ML650 100 µL

APG4B, ID (G254) (ATG4B, APG4B, AUTL1, KIAA0943, Cysteine protease ATG4B, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B) (MaxLight 650) discontinued

Sign In for Pricing
View Details