Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Type-1 angiotensin II receptor

Product Specifications

CAS Number

9000-83-3

Gene Name

Angiotensin II receptor type 1

Gene Aliases

AG2S; AGTR1B; Angiotensin II type-1 receptor; AT1; AT1AR; AT1B; AT1BR; AT1R; AT2R1; HAT1R; type-1 angiotensin II receptor; type-1B angiotensin II receptor.

Gene ID

185

Reactivity

Homo sapiens|Human

Target

Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Type

Protein

Source

Yeast

Sequence

LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

9.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AGTR1

Protein Name

Type-1 angiotensin II receptor

Gene Name URL

AGTR1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 820 Anti-human CD147 Antibody *MEM-M6/6*
114700P1-AAT 500 Tests

IFluor® 820 Anti-human CD147 Antibody *MEM-M6/6*

Sign In for Pricing
View Details
ATF-1 (m) : 293T Lysate
sc-118601 100 µg - 200 µL

ATF-1 (m) : 293T Lysate

Sign In for Pricing
View Details
OBP2A antibody - middle region (ARP55085_P050)
ARP55085_P050 100 µL

OBP2A antibody - middle region (ARP55085_P050)

Sign In for Pricing
View Details
BTF3L4 Protein Vector (Human) (pPB-His-MBP)
PV327762 500 ng

BTF3L4 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Bottle, Wide Mouth, Square, Amber HDPE
7180175AM 12/Bag

Bottle, Wide Mouth, Square, Amber HDPE

Sign In for Pricing
View Details
OR2A14 siRNA (Human)
CRJ5177-01 15 nmol

OR2A14 siRNA (Human)

Sign In for Pricing
View Details