Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Gap junction protein alpha 1

Gene Aliases

AVSD3; CMDR; connexin-43; CX43; EKVP; EKVP3; gap junction 43 kDa heart protein; gap junction alpha-1 protein; gap junction protein, alpha 1, 43kDa; GJAL; HLHS1; HSS; ODDD; PPKCA.

Gene ID

2697

Reactivity

Homo sapiens|Human

Target

Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract (By similarity) . May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles (By similarity) .

Type

Protein

Source

E.coli

Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GJA1

Protein Name

Gap junction alpha-1 protein

Gene Name URL

GJA1

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Uncharacterized protein ML2453 (ML2453)
MBS7041011-01 0.02 mg

Recombinant Uncharacterized protein ML2453 (ML2453)

Ask
View Details
Recombinant Uncharacterized protein ML2453 (ML2453)
MBS7041011-02 0.1 mg

Recombinant Uncharacterized protein ML2453 (ML2453)

Ask
View Details
Recombinant Uncharacterized protein ML2453 (ML2453)
MBS7041011-03 5x 0.1 mg

Recombinant Uncharacterized protein ML2453 (ML2453)

Ask
View Details
NUMB, NT (NUMB, Protein numb homolog, Protein S171) (MaxLight 490)
MBS6327211-01 0.1 mL

NUMB, NT (NUMB, Protein numb homolog, Protein S171) (MaxLight 490)

Ask
View Details
NUMB, NT (NUMB, Protein numb homolog, Protein S171) (MaxLight 490)
MBS6327211-02 5x 0.1 mL

NUMB, NT (NUMB, Protein numb homolog, Protein S171) (MaxLight 490)

Ask
View Details
CD49b (Integrin alpha2, ITGA2, alpha-2 subunit of VLA-2 Receptor, Platelet Antigen B) (Biotin) discontinued
C2404-06H-Biotin 100 µL

CD49b (Integrin alpha2, ITGA2, alpha-2 subunit of VLA-2 Receptor, Platelet Antigen B) (Biotin) discontinued

Ask
View Details